Product Overview
Description
CLPP-00151243 is recombinant human PHLDA2 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Sequence Similarities
Belongs to the PHLDA2 family. Contains 1 PH domain.
Target Information
Alternative Names
Beckwith Wiedemann syndrome chromosome region 1 candidate protein C; Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein; BRW 1C; BRW1C; BWR 1C; BWR1C; HLDA 2; HLDA2; Imprinted in placenta and liver; Imprinted in placenta and liver protein; IPL; p17 Beckwith Wiedemann region 1C; p17 BWR1C; p17-Beckwith-Wiedemann region 1 C; p17-BWR1C; PHLA2_HUMAN; PHLDA 2; phlda2; Pleckstrin homology like domain family A member 2; Pleckstrin homology-like domain family A member 2; TSSC 3; Tumor suppressing STF cDNA 3 protein; Tumor suppressing subchromosomal transferable fragment candidate gene 3 protein; Tumor suppressing subchromosomal transferable fragment cDNA 3; Tumor suppressing subtransferable candidate 3; Tumor supressing STF cDNA 3; Tumor-suppressing STF cDNA 3 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein
Protein Function
Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).
Tissue Specificity
Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal development of both fetus and trophoblast. The majority of hydatidiform moles are associated with an excess of paternal to maternal genomes and are likely to result from the abnormal expression of imprinted genes (at protein level). Expressed at low levels in adult liver and lung, and fetal liver. Expressed in adult brain and neuroblastoma, medullablastoma and glioblastoma cell lines.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
Constituents
0.0154% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
