Product Overview
Description
CLPP-00150976 is recombinant human PDCD4 protein
Applications
HPLC, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH
Sequence Similarities
Belongs to the PDCD4 family. Contains 2 MI domains.
Predicted Molecular Weight
17 kDa including tags
Target Information
Alternative Names
Death up-regulated gene protein; Dug; H731; Ma3; MGC33046; MGC33047; Neoplastic transformation inhibitor; Neoplastic transformation inhibitor protein; Nuclear antigen H731; Nuclear antigen H731 like; Nuclear antigen H731 like protein; Nuclear antigen H731-like; PDCD 4; Pdcd4; PDCD4_HUMAN; Programmed cell death 4; programmed cell death 4 (neoplastic transformation inhibitor); Programmed cell death protein 4; Protein 197/15a; Protein MA-3; Tis; Topoisomerase-inhibitor suppressed protein
Protein Function
Inhibits translation initiation and cap-dependent translation. May excert its function by hindering the interaction between EIF4A1 and EIF4G. Inhibits the helicase activity of EIF4A. Modulates the activation of JUN kinase. Down-regulates the expression of MAP4K1, thus inhibiting events important in driving invasion, namely, MAPK85 activation and consequent JUN-dependent transcription. May play a role in apoptosis. Tumor suppressor. Inhibits tumor promoter-induced neoplastic transformation. Binds RNA (By similarity).
Tissue Specificity
Up-regulated in proliferative cells. Highly expressed in epithelial cells of the mammary gland. Reduced expression in lung cancer and colon carcinoma.
Shipping & Handling
Constituents
100% PBS. Supplied as a 0.2 µM filtered solution.
Shipping
Shipped on Dry Ice.
Storage
Store at -20 °C or -80 °C.
