Product Overview
Description
CLPP-00150964 is recombinant human F2R protein, His tag
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Predicted Molecular Weight
10 kDa including tags
Target Information
Alternative Names
CF2R; Coagulation factor II (thrombin) receptor; Coagulation factor II receptor; F2R; HTR; PAR 1; PAR-1; PAR1; PAR1_HUMAN; Protease activated receptor 1; Proteinase activated receptor 1; Proteinase-activated receptor 1; Thrombin receptor; TR
Protein Function
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
Tissue Specificity
Platelets and vascular endothelial cells.
Shipping & Handling
Shipping
Shipped at Room Temperature.
Storage
Store at -20 °C or -80 °C.
