Product Overview
Description
CLPP-00150946 is recombinant human CDK5R1 protein
Applications
SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Sequence Similarities
Belongs to the cyclin-dependent kinase 5 activator family.
Predicted Molecular Weight
60 kDa including tags
Target Information
Alternative Names
CD5R1_HUMAN; CDK5 activator 1; CDK5P35; CDK5R; CDK5R1; Cyclin dependent kinase 5 regulatory subunit 1; Cyclin-dependent kinase 5 activator 1; Cyclin-dependent kinase 5 regulatory subunit 1; NCK 5A; Neuronal CDK5 activator; p23; p25; p35; Regulatory partner for CDK5 kinase; Tau protein kinase II 23 kDa subunit; TPKII regulatory subunit
Protein Function
p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-BMAL1 heterodimer in association with altered stability and subcellular distribution.
Tissue Specificity
Brain and neuron specific.
Shipping & Handling
Constituents
0.31% Glutathione, 0.002% PMSF, 0.003% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol (glycerin, glycerine), 0.29% Sodium chloride.
Shipping
Shipped on dry ice.
