Product Overview
Description
CLPP-00150937 is recombinant human CDKN2C protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Sequence Similarities
Belongs to the CDKN2 cyclin-dependent kinase inhibitor family. Contains 4 ANK repeats.
Predicted Molecular Weight
21 kDa including tags
Target Information
Alternative Names
CDK6 inhibitor p18; CDKN 2C; CDKN 6; Cdkn2c; CDKN6; CDN2C_HUMAN; Cyclin dependent inhibitor; Cyclin dependent kinase 4 inhibitor C; Cyclin dependent kinase 6 inhibitor; Cyclin dependent kinase 6 inhibitor p18; Cyclin dependent kinase inhibitor 2C; Cyclin dependent kinase inhibitor 2C (p18 inhibits CDK4); Cyclin-dependent kinase 4 inhibitor C; Cyclin-dependent kinase 6 inhibitor; INK4C; OTTHUMP00000046546; p18; p18 inhibits CDK4; p18 INK4c; p18 INK6; p18-INK4c; p18-INK6
Protein Function
Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB.
Tissue Specificity
Highest levels found in skeletal muscle. Also found in pancreas and heart.
Shipping & Handling
Constituents
0.03% DTT, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 1.17% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
