Product Overview
Description
CLPP-00150936 is recombinant human CDKN2C protein
Applications
SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Sequence Similarities
Belongs to the CDKN2 cyclin-dependent kinase inhibitor family. Contains 4 ANK repeats.
Target Information
Alternative Names
CDK6 inhibitor p18; CDKN 2C; CDKN 6; Cdkn2c; CDKN6; CDN2C_HUMAN; Cyclin dependent inhibitor; Cyclin dependent kinase 4 inhibitor C; Cyclin dependent kinase 6 inhibitor; Cyclin dependent kinase 6 inhibitor p18; Cyclin dependent kinase inhibitor 2C; Cyclin dependent kinase inhibitor 2C (p18 inhibits CDK4); Cyclin-dependent kinase 4 inhibitor C; Cyclin-dependent kinase 6 inhibitor; INK4C; OTTHUMP00000046546; p18; p18 inhibits CDK4; p18 INK4c; p18 INK6; p18-INK4c; p18-INK6
Protein Function
Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB.
Tissue Specificity
Highest levels found in skeletal muscle. Also found in pancreas and heart.
Shipping & Handling
Constituents
0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride.
Shipping
Shipped on dry ice.
