Product Overview
Description
CLPP-00150927 is recombinant human NUDC protein, His tag
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
Sequence Similarities
Belongs to the nudC family. Contains 1 CS domain.
Predicted Molecular Weight
40 kDa including tags
Target Information
Alternative Names
HNUDC; MNUDC; MNUDC protein; NPD011; Nuclear distribution C homolog; Nuclear distribution gene C (A.nidulans) homolog; Nuclear distribution gene C homolog; Nuclear distribution gene C homolog (A. nidulans); Nuclear distribution protein C homolog; Nuclear migration protein nudC; nudC; NudC nuclear distribution protein; NUDC_HUMAN; OTTHUMP00000004405; SIG 92; SIG92
Protein Function
Plays a role in neurogenesis and neuronal migration (By similarity). Necessary for correct formation of mitotic spindles and chromosome separation during mitosis. Necessary for cytokinesis and cell proliferation.
Tissue Specificity
Ubiquitous. Highly expressed in fetal liver, kidney, lung and brain. Highly expressed in adult pancreas, kidney, skeletal muscle, liver, lung, placenta, prostate, brain and heart.
Shipping & Handling
Constituents
20% Glycerol (glycerin, glycerine), 0.24% Tris, 2.9% Sodium chloride.
Shipping
Shipped at Room Temperature.
Storage
Store at -20 °C or -80 °C.