Product Overview
Description
CLPP-00150925 is recombinant human NUBP1 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Sequence Similarities
Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.
Predicted Molecular Weight
37 kDa including tags
Target Information
Alternative Names
MGC130052; Cytosolic Fe S cluster assembly factor NUBP1; Cytosolic Fe-S cluster assembly factor NUBP1; MGC117406; MGC130053; NBP; NBP 1; NBP1; NBP35; nubp1; NUBP1_HUMAN; Nucleotide binding protein (e.coli MinD like); Nucleotide binding protein 1; Nucleotide binding protein 1 (E.coli MinD like); Nucleotide binding protein 1 (MinD homolog, E. coli); Nucleotide-binding protein 1
Protein Function
Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Implicated in the regulation of centrosome duplication (By similarity). Negatively regulates cilium formation and structure (By similarity).
Shipping & Handling
Constituents
10% Glycerol (glycerin, glycerine), 0.02% DTT, 89% PBS.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.