Product Overview
Description
CLPP-00150921 is recombinant human SPECC1 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSTQEGKIIELEQKCTGILEQGRFEREKLLNIQQQLTCSLRKVEEENQGALEMIKRLKEENEKLNEFLE
LERHNNNMMAKTLEECRVTLEGLKMENGSLKSHLQGEKQKATEASAVEQTAESCEVQEMLKVARAEKDLLELSCNELRQELLKANGEIKHVSSLLAKVEKDYSYLKEICDHQAEQLSRTSLKLQEKASESDAEIKDMKETIFELEDQVEQHRAVKLHNNQLISELESSVIKLEEQKSDLERQLKTLTKQMKEETEEWRRFQADLQTAVVVANDIKCEAQQELRTVKRKLLEEEEKNA
Sequence Similarities
Belongs to the cytospin-A family. Contains 1 CH (calponin-homology) domain.
Predicted Molecular Weight
38 kDa including tags
Target Information
Alternative Names
Cytokinesis and spindle organization B; Cytospin B; Cytospin-B; CYTSB; CYTSB_HUMAN; FLJ36955; HCMOGT; HCMOGT 1; HCMOGT-1; NSP; NSP5; Nuclear structure protein 5; Specc1; Spectrin domain with coiled coils 1; Sperm antigen HCMOGT 1; Sperm antigen HCMOGT-1; Sperm antigen with calponin homology and coiled coil domains 1; Sperm antigen with calponin homology and coiled-coil domains 1; sperm antigen with calponin-like and coiled coil domains 1; Structure protein NSP5a3a; Structure protein NSP5a3b; Structure protein NSP5b3a; Structure protein NSP5b3b
Tissue Specificity
Highly expressed in testis. Barely detectable in other tissues. Also highly expressed in some cancer cell lines.
Involvement in Disease
A chromosomal aberration involving CYTSB may be a cause of juvenile myelomonocytic leukemia. Translocation t(5;17)(q33;p11.2) with PDGFRB.
Shipping & Handling
Constituents
0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.02% DTT, 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
