Product Overview
Description
CLPP-00150913 is recombinant human SYNE2 protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA
Sequence Similarities
Belongs to the nesprin family. Contains 1 actin-binding domain. Contains 2 CH (calponin-homology) domains. Contains 1 KASH domain. Contains 9 spectrin repeats.
Target Information
Alternative Names
DKFZP434H2235; DKFZp686E01115; DKFZp686H1931; FLJ11014; FLJ43727; FLJ45710; FLJ46790; KIAA1011; Nesprin-2; Nesprin2; NUA; NUANCE; Nuclear envelope spectrin repeat protein 2; Nucleus and actin connecting element; Nucleus and actin connecting element protein; Protein NUANCE; Spectrin repeat containing nuclear envelope 2; Synaptic nuclear envelope protein 2; Synaptic nuclei expressed gene 2; SYNE 2; Syne-2; SYNE2; SYNE2_HUMAN
Protein Function
Multi-isomeric modular protein which forms a linking network between organelles and the actin cytoskeleton to maintain the subcellular spatial organization. Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments. Involved in the maintenance of nuclear organization and structural integrity. Connects nuclei to the cytoskeleton by interacting with the nuclear envelope and with F-actin in the cytoplasm. Specifically, SYNE2 and SUN2 assemble in arrays of transmembrane actin-associated nuclear (TAN) lines which are bound to F-actin cables and couple the nucleus to retrograde actin flow during actin-dependent nuclear movement. Required for centrosome migration to the apical cell surface during early ciliogenesis.
Tissue Specificity
Widely expressed, with higher level in kidney, adult and fetal liver, stomach and placenta. Weakly expressed in skeletal muscle and brain. Isoform 5 is highly expressed in pancreas, skeletal muscle and heart.
Involvement in Disease
Defects in SYNE2 are the cause of Emery-Dreifuss muscular dystrophy type 5 (EDMD5). A degenerative myopathy characterized by weakness and atrophy of muscle without involvement of the nervous system, early contractures of the elbows, Achilles tendons and spine, and cardiomyopathy associated with cardiac conduction defects.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
