Product Overview
Description
CLPP-00150910 is recombinant human NEK7 protein, His tag
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
DEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVA
LKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSR
MIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLG
LGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKM
NLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS
S
Sequence Similarities
Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily. Contains 1 protein kinase domain.
Predicted Molecular Weight
37 kDa including tags
Target Information
Alternative Names
EC 2.7.11.1; NEK7; NEK7_HUMAN; Never in mitosis A-related kinase 7; Never in mitosis gene a-related kinase 7; NIMA (never in mitosis gene a) related kinase 7; NIMA (never in mitosis gene a)-related expressed kinase 7; NimA related protein kinase 7; NIMA-related kinase 7; NimA-related protein kinase 7; Serine/threonine-protein kinase Nek7
Protein Function
Protein kinase which plays an important role in mitotic cell cycle progression. Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis. Phosphorylates RPS6KB1 (By similarity). Phosphorylates EML4 at 'Ser-146', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression. Essential protein for NLRP3 inflammasome assembly and activation that acts downstream stimuli such as K(+) efflux. Dispensable for the induction of core inflammasome components, but necessary for subsequent formation of the NLRP3:PYCARD complex, and activation of CASP1. Serves as a cellular switch that enforces mutual exclusivity of the inflammasome response and cell division. Exerts its effects on the NLRP3 inflammasome independently of its kinase activity.
Tissue Specificity
Highly expressed in lung, muscle, testis, brain, heart, liver, leukocyte and spleen. Lower expression in ovary, prostate and kidney. No expression seen in small intestine.
Shipping & Handling
Constituents
0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.01% TCEP, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped on Dry Ice.
