Product Overview
Description
CLPP-00150914 is recombinant human NEFH protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
LKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEA
Sequence Similarities
Belongs to the intermediate filament family.
Target Information
Alternative Names
200 kDa neurofilament protein; CMT2CC; Nefh; Neurofilament heavy polypeptide; Neurofilament heavy polypeptide 200kDa; Neurofilament triplet H protein; NF H; NF-H; NFH; NFH_HUMAN
Protein Function
Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. NF-H has an important function in mature axons that is not subserved by the two smaller NF proteins.
Involvement in Disease
Defects in NEFH are a cause of susceptibility to amyotrophic lateral sclerosis (ALS). ALS is a neurodegenerative disorder affecting upper and lower motor neurons, and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology is likely to be multifactorial, involving both genetic and environmental factors.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
