Product Overview
Description
CLPP-00150901 is recombinant human NDRG2 protein, denatured
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC
Sequence Similarities
Belongs to the NDRG family.
Predicted Molecular Weight
42 kDa including tags
Target Information
Alternative Names
Antidepressant related protein ADRG123; Cytoplasmic protein Ndr1; DKFZp781G1938; FLJ25522; KIAA1248; N myc downstream regulated gene 2; N myc downstream regulator 2; NDR1 related protein NDR2; NDRG 2; NDRG family member 2; NDRG1 related protein; NDRG2; NDRG2_HUMAN; Protein NDRG2; Protein Syld709613; SYLD; Syld709613 protein
Protein Function
Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation.
Tissue Specificity
Highly expressed in brain, heart, skeletal muscle and salivary gland, and moderately in kidney and liver. Expressed in dendritic cells, but not in other blood cells. Expression levels are low in pancreatic and liver cancer tissues; absent in meningioma. Expressed in low-grade gliomas but present at low levels in glioblastoma. Isoform 1 and isoform 2 are present in brain neurons and up-regulated in Alzheimer disease (at protein level).
Shipping & Handling
Constituents
2.4% Urea, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
