Product Overview
Description
CLPP-00150314 is recombinant human beta-cardiac myosin heavy chain / myosin heavy chain 7 protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRY
Predicted Molecular Weight
38 kDa including tags
Target Information
Alternative Names
MYH7; Myosin Heavy Chain 7; Cardiomyopathy, hypertrophic 1; CMD1S; CMH1; MPD1; MyHC beta; MYHCB; Myosin heavy chain, cardiac muscle beta isoform; myosin, heavy polypeptide 7, cardiac muscle, beta
Protein Function
Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Cardiac MHC exists as two isoforms in humans, alpha-cardiac MHC and beta-cardiac MHC. These two isoforms are expressed in different amounts in the human heart. During normal physiology, beta-cardiac MHC is the predominant form, with the alpha-isoform contributing around only 7% of the total MHC. Mutations of the MHC genes are associated with several different dilated and hypertrophic cardiomyopathies.
Shipping & Handling
Shipping
Shipped on dry ice.
Constituents
0.31% Glutathione, 0.79% Tris HCl.
