Product Overview
Description
CLPP-00150875 is recombinant human MYL9 protein
Applications
Mass Spectrometry, SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYL
EGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFT
RILKHGAKDKDD
Sequence Similarities
Contains 3 EF-hand domains.
Predicted Molecular Weight
22 kDa
Target Information
Alternative Names
20 kDa myosin light chain; Human 20kDa myosin light chain (MLC2) mRNA complete cds; LC20; MGC3505; MLC 2; MLC-2C; MLC2; MLY 9; MRLC1; MYL9; MYL9_HUMAN; Myosin light chain 9 regulatory; Myosin light polypeptide 9 regulatory; myosin regulatory light chain 1; Myosin regulatory light chain 2; Myosin regulatory light chain 2 smooth muscle isoform; Myosin regulatory light chain 9; Myosin regulatory light chain MRLC1; Myosin regulatory light polypeptide 9; Myosin RLC; Myosin vascular smooth muscle light chain 2; MYRL2; OTTHUMP00000030857; smooth muscle isoform
Protein Function
Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.
Tissue Specificity
Smooth muscle tissues and in some, but not all, nonmuscle cells.
Involvement in Disease
Megacystis-microcolon-intestinal hypoperistalsis syndrome 4 (MMIHS4): A form of megacystis-microcolon-intestinal hypoperistalsis syndrome, a congenital visceral myopathy primarily affecting females, and characterized by loss of smooth muscle contraction in the bladder and intestine. Affected individuals present at birth with functional obstruction of intestine, microcolon, dilation of bladder, and secondary hydronephrosis. The majority of cases have a fatal outcome due to malnutrition and sepsis, followed by multiorgan failure. MMIHS4 inheritance is autosomal recessive. The disease may be caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.0154% DTT, 0.316% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.