Product Overview
Description
CLPP-00150871 is recombinant human MYL4 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSGLEHHHHHH
Sequence Similarities
Contains 3 EF-hand domains.
Predicted Molecular Weight
23 kDa including tags
Target Information
Alternative Names
ALC 1; ALC1; AMLC; Atrial/embryonic alkali myosin light chain; embryonic muscle/atrial isoform; GT 1; GT1; MLC 1; MLC1; MYL 4; Myl4; MYL4_HUMAN; Myosin atrial/fetal muscle light chain; Myosin light chain 1; Myosin light chain 1 embryonic muscle/atrial isoform; Myosin light chain 4; Myosin light chain 4 alkali atrial embryonic; Myosin light chain alkali GT 1 isoform; Myosin light chain alkali GT-1 isoform; Myosin light polypeptide 4; Myosin light polypeptide 4 alkali atrial embryonic; PRO1957
Protein Function
Regulatory light chain of myosin. Does not bind calcium.
Involvement in Disease
Atrial fibrillation, familial, 18 (ATFB18): A familial form of atrial fibrillation, a common sustained cardiac rhythm disturbance. Atrial fibrillation is characterized by disorganized atrial electrical activity and ineffective atrial contraction promoting blood stasis in the atria and reduces ventricular filling. It can result in palpitations, syncope, thromboembolic stroke, and congestive heart failure. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.