Product Overview
Description
CLPP-00150878 is recombinant human MYL11 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Predicted Molecular Weight
21 kDa including tags
Sequence Similarities
Contains 3 EF-hand domains.
Target Information
Alternative Names
2410014J02Rik; DKFZp779C0757; DTNB; Fast skeletal myosin light chain 2; G2; HUMMLC2B; MGC13450; MLC 2; MLC2B; MLC2F; MLRS_HUMAN; MRLC2; MYL11; MYLPF; Myosin light polypeptide 2 alkali; Myosin regulatory light chain 2; skeletal muscle isoform
Protein Function
Myosin regulatory subunit that plays an essential role to maintain muscle integrity during early development (By similarity). Plays a role in muscle contraction (By similarity).
Involvement in Disease
Arthrogryposis, distal, 1C (DA1C): A form of distal arthrogryposis, a disease characterized by congenital joint contractures that mainly involve two or more distal parts of the limbs, in the absence of a primary neurological or muscle disease. DA1C patients show multiple congenital contractures, scoliosis, short stature, and segmental amyoplasia. DA1C inheritance can be autosomal recessive or autosomal dominant. The disease is caused by variants affecting the gene represented in this entry.
Tissue Specificity
Expressed in fetal and adult skeletal muscle.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
Constituents
0.0154% DTT, 0.316% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.