Product Overview
Description
CLPP-00150867 is recombinant human MRAS protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPMATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQC
Predicted Molecular Weight
26 kDa including tags
Sequence Similarities
Belongs to the small GTPase superfamily. Ras family.
Target Information
Alternative Names
FLJ42964; M ras; M-ras; Mras; Muscle and microspikes Ras; Muscle RAS oncogene homolog; Muscle Ras oncogene homologue; Muscle Ras viral oncogene homolog; R ras3; R-ras3; Ras related protein MRas; Ras related protein RRas3; Ras-related protein M-Ras; Ras-related protein R-Ras3; RASM_HUMAN; Related Ras viral oncogene homolog 3; RRas3; XRas
Protein Function
May serve as an important signal transducer for a novel upstream stimuli in controlling cell proliferation. Weakly activates the MAP kinase pathway.
Involvement in Disease
Noonan syndrome 11 (NS11): A form of Noonan syndrome, a disease characterized by short stature, facial dysmorphic features such as hypertelorism, a downward eyeslant and low-set posteriorly rotated ears, and a high incidence of congenital heart defects and hypertrophic cardiomyopathy. Other features can include a short neck with webbing or redundancy of skin, deafness, motor delay, variable intellectual deficits, multiple skeletal defects, cryptorchidism, and bleeding diathesis. Individuals with Noonan syndrome are at risk of juvenile myelomonocytic leukemia, a myeloproliferative disorder characterized by excessive production of myelomonocytic cells. NS11 inheritance is autosomal dominant. The disease is caused by variants affecting the gene represented in this entry.
Tissue Specificity
Expression highly restricted to the brain and heart.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
Constituents
0.08% DTT, 0.32% Tris HCl, 0.06% EDTA, 40% Glycerol (glycerin, glycerine), 1.17% Sodium chloride.
