Product Overview
Description
Recombinant human MLF1 Interacting protein/PBIP1
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESVTSKKTGPLSAQPSVEKENLAIESQSKTQKKGK
ISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLTNLK
RKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFK
ARTLLGAESHLRNINHQLEKLLDQG
Predicted Molecular Weight
34 kDa including tags
Target Information
Alternative Names
CENP U; CENP-50; CENP-U; CENP50; CENPU; CENPU_HUMAN; CENPU50; centromere protein of 50 kDa; Centromere protein U; FLJ23468; HHV8 LNAIP1; ICEN24; Interphase centromere complex protein 24; Kaposi Sarcoma Herpesvirus latent nuclear antigen interacting protein 1; KLIP-1; KLIP1; KSHV latent nuclear antigen interacting protein 1; KSHV latent nuclear antigen-interacting protein 1; KSHV LNAIP1; LNAIP 1; LNAIP-1; MLF1-interacting protein; MLF1IP; MLF1IP1; PBIP1; Polo-box-interacting protein 1
Protein Function
Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Plays an important role in the correct PLK1 localization to the mitotic kinetochores. A scaffold protein responsible for the initial recruitment and maintenance of the kinetochore PLK1 population until its degradation. Involved in transcriptional repression.
Tissue Specificity
Expressed at high levels in the testis, fetal liver, thymus, bone marrow and at lower levels in the lymph nodes, placenta, colon and spleen. Present in all cell lines examined, including B-cells, T-cells, epithelial cells and fibroblast cells. Expressed at high levels in glioblastoma cell lines.
Shipping & Handling
Constituents
0.32% Tris HCl, 2.4% Urea, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
