Product Overview
Description
CLPP-00150860 is recombinant human MAP2K6 protein, denatured
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFR
EGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDEVAKE
IDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKE
RPTYPELMQHPFF
Sequence Similarities
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. Contains 1 protein kinase domain.
Predicted Molecular Weight
32 kDa including tags
Target Information
Alternative Names
Dual specificity mitogen activated protein kinase kinase 6; Dual specificity mitogen-activated protein kinase kinase 6; MAP kinase kinase 6; MAP2K6; MAPK/ERK kinase 6; MAPKK 6; MAPKK6; MEK 6; MEK6; Mitogen Activated Protein Kinase Kinase 6; MKK 6; MKK6; MP2K6_HUMAN; PRKMK6; protein kinase; Protein kinase mitogen activated kinase 6; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); SAPK kinase 3; SAPKK-3; SAPKK3; SKK3; Stress-activated protein kinase kinase 3
Protein Function
Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.
Tissue Specificity
Isoform 2 is only expressed in skeletal muscle. Isoform 1 is expressed in skeletal muscle, heart, and in lesser extent in liver or pancreas.
Shipping & Handling
Constituents
0.32% Tris HCl, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.