Product Overview
Description
CLPP-00150853 is recombinant human NTMT1 protein, His tag
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSEFMTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCA
LDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKG
SLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR
Sequence Similarities
Belongs to the methyltransferase superfamily. NTM1 family.
Predicted Molecular Weight
28 kDa including tags
Target Information
Alternative Names
AD 003; Alpha N-terminal protein methyltransferase 1A; C9orf32; Chromosome 9 open reading frame 32; Methyltransferase like 11A; Methyltransferase-like protein 11A; Mettl11a; N-terminal RCC1 methyltransferase; NRMT; NTM1A; NTM1A_HUMAN; NTMT1; X-Pro-Lys N-terminal protein methyltransferase 1A
Protein Function
Distributive alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif -Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of the exposed alpha-amino group of the Ala, Gly or Ser residue in the -Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif. Some of the substrates may be primed by NTMT2-mediated monomethylation. Catalyzes the trimethylation of the N-terminal Gly in CENPA (after removal of Met-1). Responsible for the N-terminal methylation of KLHL31, MYL2, MYL3, RB1, RCC1, RPL23A and SET. Required during mitosis for normal bipolar spindle formation and chromosome segregation via its action on RCC1.
Shipping & Handling
Constituents
0.32% Tris HCl, 0.87% Sodium chloride, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
