Product Overview
Description
CLPP-00150833 is recombinant human MTDH protein, His tag
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MKHHHHHHASVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKAEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDN
Predicted Molecular Weight
22 kDa including tags
Endotoxin Level
< 1.000 Eu/µg
Target Information
Alternative Names
3D3; 3D3/LYRIC; AEG 1; AEG-1; AEG1; Astrocyte elevated gene 1; Astrocyte elevated gene-1 protein; LYRIC; LYRIC/3D3; LYRIC_HUMAN; Lysine rich CEACAM1 associated protein; Lysine rich CEACAM1 co isolated protein; Lysine-rich CEACAM1 co-isolated protein; Metadherin; Metastasis adhesion protein; MTDH; Protein LYRIC
Protein Function
Downregulates SLC1A2/EAAT2 promoter activity when expressed ectopically. Activates the nuclear factor kappa-B (NF-kappa-B) transcription factor. Promotes anchorage-independent growth of immortalized melanocytes and astrocytes which is a key component in tumor cell expansion. Promotes lung metastasis and also has an effect on bone and brain metastasis, possibly by enhancing the seeding of tumor cells to the target organ endothelium. Induces chemoresistance.
Tissue Specificity
Widely expressed with highest levels in muscle-dominating organs such as skeletal muscle, heart, tongue and small intestine and in endocrine glands such as thyroid and adrenal gland. Overexpressed in various cancers including breast, brain, prostate, melanoma and glioblastoma multiforme.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
Constituents
0.32% Tris buffer, 0.29% Sodium chloride.