Product Overview
Description
CLPP-00150852 is recombinant human MEMO1 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMMSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH
Sequence Similarities
Belongs to the MEMO1 family.
Predicted Molecular Weight
36 kDa including tags
Target Information
Alternative Names
C21orf19-like protein; C2orf4; CGI 27; DKFZp434I0135; FLJ25031; HCV NS5A-transactivated protein 7; Hepatitis C virus NS5A-transactivated protein 7; Mediator of cell motility 1; Mediator of ErbB2-driven cell motility 1; MEMO; Memo-1; memo1; MEMO1_HUMAN; NS5ATP7; Protein MEMO1
Protein Function
May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Is required for breast carcinoma cell migration.
Shipping & Handling
Constituents
0.08% DTT, 0.32% Tris HCl, 0.06% EDTA, 50% Glycerol (glycerin, glycerine), 1.75% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
