Product Overview
Description
CLPP-00150840 is recombinant human MAPRE1 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MASMTGGQQMGRGHHHHHHENLYFQGGEFAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
Sequence Similarities
Belongs to the MAPRE family. Contains 1 CH (calponin-homology) domain. Contains 1 EB1 C-terminal domain.
Predicted Molecular Weight
33 kDa including tags
Target Information
Alternative Names
5530600P05Rik; Adenomatous polyposis coli binding protein EB 1; Adenomatous polyposis coli binding protein EB1; AI462499; AI504412; APC binding protein EB 1; APC binding protein EB1; APC-binding protein EB1; AW260097; BIM1p; D2Ertd459e; EB 1; EB1; End binding protein 1; End-binding protein 1; fa01e12; fc23e11; fi33c06; MAPRE 1; MAPRE1; Mapre3; MARE1_HUMAN; MGC117374; MGC129946; MGC52508; Microtubule associated protein RP/EB family member 1; Microtubule-associated protein RP/EB family member 1; wu:fa01e12; wu:fc23e11; wu:fi33c06; zgc:55428; zgc:77807; zgc:85755
Protein Function
Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. Involved in mitotic spindle positioning by stabilizing microtubules and promoting dynamic connection between astral microtubules and the cortex during mitotic chromosome segregation. Also acts as a regulator of minus-end microtubule organization: interacts with the complex formed by AKAP9 and PDE4DIP, leading to recruit CAMSAP2 to the Golgi apparatus, thereby tethering non-centrosomal minus-end microtubules to the Golgi, an important step for polarized cell movement. Promotes elongation of CAMSAP2-decorated microtubule stretches on the minus-end of microtubules. Acts as a regulator of autophagosome transport via interaction with CAMSAP2. May play a role in cell migration (By similarity).
Tissue Specificity
Ubiquitously expressed.
Shipping & Handling
Constituents
0.32% Tris HClContains NaCl, EDTA, KCl, Arginine, DTT and Glycerol.
Shipping
Shipped at 4 °C.
