Product Overview
Description
CLPP-00150837 is recombinant human MAP1LC3A protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGLEHHHHHH
Sequence Similarities
Belongs to the MAP1 LC3 family.
Predicted Molecular Weight
15 kDa including tags
Target Information
Alternative Names
ATG8E; Autophagy related protein LC3 A; Autophagy related ubiquitin like modifier LC3 A; Autophagy-related protein LC3 A; Autophagy-related ubiquitin-like modifier LC3 A; LC3; LC3A; MAP1 light chain 3 like protein 1; MAP1 light chain 3-like protein 1; MAP1A/1B light chain 3 A; MAP1A/MAP1B LC3 A; MAP1A/MAP1B light chain 3 A; MAP1ALC3; MAP1BLC3; Map1lc3a; Microtubule associated proteins 1A/1B light chain 3; Microtubule-associated protein 1 light chain 3 alpha; Microtubule-associated proteins 1A and 1B, light chain 3; Microtubule-associated proteins 1A/1B light chain 3A; MLP3A_HUMAN
Protein Function
Probably involved in formation of autophagosomal vacuoles (autophagosomes).
Tissue Specificity
Most abundant in heart, brain, liver, skeletal muscle and testis but absent in thymus and peripheral blood leukocytes.
Shipping & Handling
Constituents
0.0154% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
