Product Overview
Description
CLPP-00150836 is recombinant human MAD2L1 protein, His tag
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Predicted Molecular Weight
24 kDa including tags
Sequence Similarities
Belongs to the MAD2 family. Contains 1 HORMA domain.
Endotoxin Level
< 1.000 Eu/µg
Target Information
Alternative Names
HsMAD 2; HsMAD2; MAD 2; MAD 2A; MAD2 like 1; MAD2 like protein 1; MAD2 mitotic arrest deficient like 1; MAD2-like protein 1; Mad2l1; MD2L1_HUMAN; Mitotic arrest deficient 2-like protein 1; Mitotic arrest deficient yeast homolog like 1; Mitotic spindle assembly checkpoint protein MAD2A
Protein Function
Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. In the closed conformation (C-MAD2) forms a heterotetrameric complex with MAD1L1 at unattached kinetochores during prometaphase, the complex recruits open conformation molecules of MAD2L1 (O-MAD2) and then promotes the conversion of O-MAD2 to C-MAD2. Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Stored with a carrier protein are stable for at least 3 months at -20 °C to -80 °C.
Constituents
5% Trehalose, 95% PBS.
