Product Overview
Description
CLPP-00150834 is recombinant human CDH15 protein
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFLPYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFLNAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAWAHNSRNLVAAALRVVAVAVVVAAVAN
Sequence Similarities
Contains 5 cadherin domains.
Predicted Molecular Weight
26 kDa including tags
Tags
His-T7 tag N-Terminus
Target Information
Alternative Names
CAD15_HUMAN; Cadherin 14; Cadherin 15; Cadherin 15, type 1, M cadherin (myotubule); Cadherin 3; Cadherin-14; Cadherin-15; Cadherin14; Cadherin15; Cadherin3; CCAD; CDH 14; CDH 15; CDH 3; CDH14; Cdh15; CDH3; CDHM; M-cadherin; MCAD; MRD3; Muscle cadherin; Myotubule cadherin
Protein Function
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. M-cadherin is part of the myogenic program and may provide a trigger for terminal muscle differentiation.
Tissue Specificity
Expressed in the brain and cerebellum.
Involvement in Disease
A chromosomal aberration involving CDH15 and KIRREL3 is found in a patient with severe mental retardation and dysmorphic facial features. Translocation t(11;16)(q24.2;q24).Mental retardation, autosomal dominant 3.
Shipping & Handling
Constituents
0.32% Tris HClBuffer also contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Shipping
Shipped at 4 °C.
