Recombinant Human LATS1/WARTS Protein

Cat. No.: CLPP-00150821

Product Size: 5 µg Custom size

Product Overview

Description
CLPP-00150821 is recombinant human LATS1 protein
Applications
Functional Studies, SDS-PAGE, Western Blot
Protein Length
Protein fragment
Animal Free
No
Nature
Recombinant Protein
Species
Human
Form
Liquid
Sequence
KEDESEKSYENVDSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV
Sequence Similarities
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. Contains 1 AGC-kinase C-terminal domain. Contains 1 protein kinase domain. Contains 1 UBA domain.
Predicted Molecular Weight
95 kDa including tags

Target Information

Protein Name
LATS1
UniProt No.
Alternative Names
h-warts; Large tumor suppressor homolog 1; LATS large tumor suppressor homolog 1; LATS1; LATS1_HUMAN; Serine threonine protein kinase LATS1; Serine/threonine-protein kinase LATS1; WARTS; WARTS protein kinase; wts
Protein Function
Negative regulator of YAP1 in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Acts as a tumor suppressor which plays a critical role in maintenance of ploidy through its actions in both mitotic progression and the G1 tetraploidy checkpoint. Negatively regulates G2/M transition by down-regulating CDK1 kinase activity. Involved in the control of p53 expression. Affects cytokinesis by regulating actin polymerization through negative modulation of LIMK1. May also play a role in endocrine function. Plays a role in mammary gland epithelial cell differentiation, both through the Hippo signaling pathway and the intracellular estrogen receptor signaling pathway by promoting the degradation of ESR1.
Tissue Specificity
Expressed in all adult tissues examined except for lung and kidney.

Shipping & Handling

pH
pH: 7.5
Constituents
0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol (glycerin, glycerine), 0.88% Sodium chloride
.
Shipping
Shipped on dry ice.
Storage
Store at -80 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry