Product Overview
Description
CLPP-00150816 is recombinant human L3MBTL2 protein
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MHHHHHHGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSDAVLPSRVYWIASVIQTAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILVPPRTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSDMAHHPTFRKIYCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGNICVATVCKVLLDGYLMICVDGGPSTDGLDWFCYHASSHAIFPATFCQKNDIELTPPKGYEAQTFNWENYLEKTKSKAAPSRLFNMDCPNHGFKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDSEYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQ
Sequence Similarities
Contains 1 FCS-type zinc finger. Contains 4 MBT repeats.
Predicted Molecular Weight
52 kDa including tags
Target Information
Alternative Names
3bt like 2 protein; 3bt like protein; DKFZP761I141; H-l(3)mbt-like protein; H-l(3)mbt-like protein 2; Hl; Hl(3)mbt like protein; Hl(3)mbtl; L; l(3)mbt like 2; l(3)mbt like 2 (Drosophila); L(3)mbt-like 2 protein; L(3)mbt-like protein 2; L3MBTL2; Lethal; Lethal(3)malignant brain tumor-like 2 protein; Lethal(3)malignant brain tumor-like protein 2; LMBL2_HUMAN
Protein Function
Putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis. Binds to monomethylated and dimethylated 'Lys-20' on histone H4. Binds histone H3 peptides that are monomethylated or dimethylated on 'Lys-4', 'Lys-9' or 'Lys-27'.
Shipping & Handling
Constituents
0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol (glycerin, glycerine).
Shipping
Shipped on Dry Ice.
