Product Overview
Description
CLPP-00150798 is recombinant human ARL6IP5 protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF
Sequence Similarities
Belongs to the PRA1 family.
Target Information
Alternative Names
Addicsin; ADP ribosylation factor like protein 6 interacting protein 5; ADP ribosylation like factor 6 interacting protein 5; ADP-ribosylation factor-like protein 6-interacting protein 5; Aip 5; Aip-5; Aip5; ARL 6 interacting protein 5; ARL-6-interacting protein 5; ARL6IP5; Cytoskeleton related vitamin A responsive protein; Cytoskeleton-related vitamin A-responsive protein; Dermal papilla derived protein 11; Dermal papilla-derived protein 11; DERP 11; DERP11; Glutamate transporter EAAC1-interacting protein; Glutamate transporter EEAC 1 associated protein; Glutamate transporter EEAC1 associated protein; GTRAP3 18; GTRAP3-18; Hp 22; Hp22; HSPC 127; HSPC127; JM 5; JM5; JMX; JWA; PRA 1 domain family 3; PRA 2; PRA1 domain family 3; PRA1 family protein 3; PRA2; PRAF 3; PRAF3; PRAF3_HUMAN; Prenylated Rab acceptor protein 2; Protein JWa; Putative MAPK activating protein PM27; Putative MAPK-activating protein PM27
Protein Function
Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate in a PKC activity-dependent manner. Plays a role in the retention of SLC1A1/EAAC1 in the endoplasmic reticulum.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
