Recombinant Human JAB1 Protein

Cat. No.: CLPP-00150782

Product Size: 10 µg Custom size

Product Overview

Description
CLPP-00150782 is recombinant human COPS5 protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Full length protein
Animal Free
No
Nature
Recombinant Protein
Species
Human
Form
Liquid
Sequence
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
Sequence Similarities
Belongs to the peptidase M67A family. CSN5 subfamily. Contains 1 MPN (JAB/Mov34) domain.
Predicted Molecular Weight
62 kDa including tags

Target Information

Protein Name
COPS5
UniProt No.
Alternative Names
38 kDa Mov34 homolog; COP9 (constitutive photomorphogenic) homolog subunit 5; COP9 constitutive photomorphogenic homolog subunit 5; COP9 signalosome complex subunit 5; COP9 signalosome subunit 5; Cop9 subunit 5; COPS 5; cops5; CSN 5; CSN5; CSN5_HUMAN; JAB 1; Jun activation domain binding protein; Jun activation domain binding protein 1; Jun activation domain-binding protein 1; MGC3149; MOV 34; MOV34; MOV34 family, 38-KD member; SGN 5; SGN5; Signalosome subunit 5
Protein Function
Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex. Promotes the proteasomal degradation of BRSK2.

Shipping & Handling

pH
pH: 8.0
Constituents
0.31% Glutathione, 0.79% Tris HCl. Note: Reduced Glutathione.
Shipping
Shipped on dry ice.
Storage
Store at -80 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry