Product Overview
Description
CLPP-00150771 is recombinant human IGSF10 protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
SAFISPQGFMAPFGSLTLNMTDQSGNEANMVCSIQKPSRTSPIAFTEENDYIVLNTSFSTFLVCNIDYGHIQPVWQILALYSDSPLILERSHLLSETPQ
Sequence Similarities
Contains 12 Ig-like C2-type (immunoglobulin-like) domains. Contains 6 LRR (leucine-rich) repeats. Contains 1 LRRCT domain. Contains 1 LRRNT domain.
Target Information
Alternative Names
6530405F15Rik; 9030224D03; AA409708; AA536958; Adlican2; AI414626; Calvaria mechanical force protein 608; CMF608; IGS10_HUMAN; IgSF10; Immunoglobulin superfamily member 10
Protein Function
Involved in the control of early migration of neurons expressing gonadotropin-releasing hormone (GNRH neurons) (By similarity). May be involved in the maintenance of osteochondroprogenitor cells pool (By similarity).
Involvement in Disease
Mutations in IGSF10 may be a cause of self-limited delayed puberty. This common condition is defined as the absence of testicular enlargement in boys or breast development in girls at an age that is 2-2.5 standard deviations later than the population mean. Self-limited delayed puberty segregates within families, with the majority of families displaying an autosomal dominant pattern of inheritance.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
