Product Overview
Description
CLPP-00150766 is recombinant human AIF1 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Predicted Molecular Weight
19 kDa including tags
Sequence Similarities
Contains 2 EF-hand domains.
Target Information
Alternative Names
AIF 1; AIF-1; Aif1; AIF1 protein; AIF1_HUMAN; Allograft inflammatory factor 1; Allograft inflammatory factor 1 splice variant G; allograft inflammatory factor-1 splice variant Hara-1; balloon angioplasty responsive transcription; BART 1; G1; G1 putative splice variant of allograft inflamatory factor 1; IBA 1; IBA1; interferon gamma responsive transcript; Interferon responsive transcript 1; interferon responsive transcript factor 1; Ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule; Ionized calcium-binding adapter molecule 1; IRT 1; IRT1; Microglia response factor; MRF1; Protein g1
Protein Function
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
Tissue Specificity
Detected in T-lymphocytes and peripheral blood mononuclear cells.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
Constituents
0.0308% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 1.16% Sodium chloride.
