Recombinant Human GTPase HRAS Protein

Cat. No.: CLPP-00150747

Product Size: 100 µg Custom size

Product Overview

Description
CLPP-00150747 is recombinant human HRAS protein
Purity
> 90%
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Animal Free
No
Nature
Recombinant Protein
Species
Human
Form
Liquid
Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCLEHHHHHH
Sequence Similarities
Belongs to the small GTPase superfamily. Ras family.
Predicted Molecular Weight
22 kDa
Tags
His tag C-Terminus

Target Information

Protein Name
HRAS
UniProt No.
Alternative Names
C BAS/HAS; c H ras; C HA RAS1; c has/bas p21 protein; c ras Ki 2 activated oncogene; c-H-ras; CTLO; GTP and GDP binding peptide B; GTPase HRas, N-terminally processed; H Ras 1; H RASIDX; H-Ras-1; Ha Ras; Ha Ras1 proto oncoprotein; Ha-Ras; HAMSV; Harvey rat sarcoma viral oncogene homolog; Harvey rat sarcoma viral oncoprotein; HRAS; HRAS1; K ras; N ras; p19 H RasIDX protein; p21ras; Ras family small GTP binding protein H Ras; RASH_HUMAN; RASH1; Transformation gene oncogene HAMSV; Transforming protein p21; v Ha ras Harvey rat sarcoma viral oncogene homolog; VH Ras; vHa RAS
Protein Function
Involved in the activation of Ras protein signal transduction. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Involvement in Disease
Defects in HRAS are the cause of faciocutaneoskeletal syndrome (FCSS). A rare condition characterized by prenatally increased growth, postnatal growth deficiency, mental retardation, distinctive facial appearance, cardiovascular abnormalities (typically pulmonic stenosis, hypertrophic cardiomyopathy and/or atrial tachycardia), tumor predisposition, skin and musculoskeletal abnormalities.Defects in HRAS are the cause of congenital myopathy with excess of muscle spindles (CMEMS). CMEMS is a variant of Costello syndrome.Defects in HRAS may be a cause of susceptibility to Hurthle cell thyroid carcinoma (HCTC). Hurthle cell thyroid carcinoma accounts for approximately 3% of all thyroid cancers. Although they are classified as variants of follicular neoplasms, they are more often multifocal and somewhat more aggressive and are less likely to take up iodine than are other follicular neoplasms.Mutations which change positions 12, 13 or 61 activate the potential of HRAS to transform cultured cells and are implicated in a variety of human tumors.Defects in HRAS are a cause of susceptibility to bladder cancer (BLC). A malignancy originating in tissues of the urinary bladder. It often presents with multiple tumors appearing at different times and at different sites in the bladder. Most bladder cancers are transitional cell carcinomas. They begin in cells that normally make up the inner lining of the bladder. Other types of bladder cancer include squamous cell carcinoma (cancer that begins in thin, flat cells) and adenocarcinoma (cancer that begins in cells that make and release mucus and other fluids). Bladder cancer is a complex disorder with both genetic and environmental influences.Defects in HRAS are the cause of oral squamous cell carcinoma (OSCC).

Shipping & Handling

pH
pH: 8.0
Constituents
0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry