Product Overview
Description
CLPP-00150541 is recombinant human ARHGDIB protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Predicted Molecular Weight
49 kDa including tags
Sequence Similarities
Belongs to the Rho GDI family.
Target Information
Alternative Names
Arhgdib; D4; D4 GDP dissociation inhibitor; GDIA 2; GDIA2; GDID 4; GDID4; GDIR2_HUMAN; GDP dissociation inhibitor D4; LY GDI; Ly-GDI; LYGDI; MGC108926; RAP1GN1; Rho GDI 2; Rho GDI beta; Rho GDI2; Rho GDP dissociation inhibitor (GDI) beta; Rho GDP dissociation inhibitor 2; Rho GDP dissociation inhibitor beta; Rho GDP-dissociation inhibitor 2; Rho-GDI beta; RhoGDI2
Protein Function
Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Regulates reorganization of the actin cytoskeleton mediated by Rho family members.
Tissue Specificity
Detected in bone marrow, thymus and spleen.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
Constituents
89% PBS, 10% Glycerol (glycerin, glycerine).
