Product Overview
Description
CLPP-00150718 is recombinant human GDF15 protein, mutated D197H
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MARNGDDCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
Sequence Similarities
Belongs to the TGF-beta family.
Predicted Molecular Weight
12 kDa
Target Information
Alternative Names
GDF 15; GDF-15; Gdf15; GDF15_HUMAN; Growth differentiation factor 15; Growth/differentiation factor 15; Macrophage inhibitory cytokine 1; MIC 1; Mic-1; MIC1; NAG 1; NAG-1; NAG1; NRG 1; NRG-1; NRG1; NSAID; NSAID (nonsteroidal anti inflammatory drug) activated protein 1; NSAID regulated protein 1; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; PDF; PLAB; Placental bone morphogenetic protein; Placental bone morphogenic protein; Placental TGF beta; Placental TGF-beta; Prostate differentiation factor; PTGF beta; PTGFB
Protein Function
Regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor, GFRAL, and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions. On hepatocytes, inhibits growth hormone signaling (By similarity).
Tissue Specificity
Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney.
Involvement in Disease
Plasma levels are increased in children with concomitant heart disease and failure to thrive but not in children with heart disease and normal body weight.
Shipping & Handling
Constituents
0.1% Trifluoroacetic acid, 0.2 micron filtered.
Shipping
Shipped at Room Temperature.