Product Overview
Description
CLPP-00150714 is recombinant human GDF11 protein, Active
Applications
Functional Studies, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Sequence Similarities
Belongs to the TGF-beta family.
Predicted Molecular Weight
13 kDa
Target Information
Alternative Names
BMP 11; BMP-11; BMP11; Bone morphogenetic protein 11; GDF 11; GDF-11; Gdf11; GDF11_HUMAN; Growth differentiation factor 11; Growth/differentiation factor 11
Protein Function
Secreted signal that acts globally to regulate anterior/posterior axial patterning during development. May play critical roles in patterning both mesodermal and neural tissues (By similarity). It is required for proper vertebral patterning and orofacial development. Signals through activin receptors type-2, ACVR2A and ACVR2B, and activin receptors type-1, ACVR1B, ACVR1C and TGFBR1 leading to the phosphorylation of SMAD2 and SMAD3.
Involvement in Disease
Vertebral hypersegmentation and orofacial anomalies (VHO): An autosomal dominant disease characterized by supernumerary ribs, supernumerary cervical, thoracic and/or lumbar vertebrae, and orofacial anomalies such as cleft lip with or without cleft palate in most patients. The disease may be caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.1% Trifluoroacetic acid.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
