Product Overview
Description
CLPP-00150700 is recombinant human LGALS3 protein, Active
Applications
Functional Studies, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Sequence Similarities
Contains 1 galectin domain.
Predicted Molecular Weight
26 kDa
Actual Molecular Weight
26 kDa
Target Information
Alternative Names
35 kDa lectin; Carbohydrate binding protein 35; Carbohydrate-binding protein 35; CBP 35; CBP35; Gal-3; GAL3; Galactose-specific lectin 3; Galactoside-binding protein; GALBP; Galectin 3 internal gene,included; Galectin-3; Galectin3; GALIG; GBP; IgE binding protein; IgE-binding protein; L 31; L 34; L-31; L-34 galactoside-binding lectin; L31; Laminin-binding protein; Lectin L-29; Lectin, galactose binding, soluble 3; LEG3_HUMAN; LGALS2; LGALS3; MAC 2 antigen; Mac-2; Mac-2 antigen; MAC2; Macrophage galactose-specific lectin; MGC105387
Protein Function
Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity). In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes.
Tissue Specificity
A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store under desiccating conditions.
