Product Overview
Description
CLPP-00150695 is recombinant human LGALS1 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC
NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM
AADGDFKIKCVAFD
Sequence Similarities
Contains 1 galectin domain.
Predicted Molecular Weight
15 kDa
Target Information
Alternative Names
14 kDa laminin-binding protein; 14 kDa lectin; Beta galactoside binding lectin; Beta galactoside binding lectin L 14 I; beta galactoside binding protein; Beta-galactoside-binding lectin L-14-I; DKFZp686E23103; Gal 1; Gal-1; GAL1; Galaptin; Galbp; Galectin; Galectin-1; Galectin1; GBP; HBL; HLBP14; HPL; L 14.5; L-14.5; L14; Lactose binding lectin 1; Lactose-binding lectin 1; Lect14; Lectin galactoside binding soluble 1; Lectin galactoside-binding soluble 1; LEG1_HUMAN; LGALS 1; LGALS1; Lgals1 lectin galactose binding soluble 1; MAPK activating protein MP12; Putative MAPK activating protein MP12; Putative MAPK-activating protein PM12; S Lac lectin 1; S-Lac lectin 1
Protein Function
Lectin that binds beta-galactoside and a wide array of complex carbohydrates. Plays a role in regulating apoptosis, cell proliferation and cell differentiation. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Lyn kinase. Strong inducer of T-cell apoptosis.
Tissue Specificity
Expressed in placenta, maternal decidua and fetal membranes. Within placenta, expressed in trophoblasts, stromal cells, villous endothelium, syncytiotrophoblast apical membrane and villous stroma. Within fetal membranes, expressed in amnion, chorioamniotic mesenchyma and chorion (at protein level). Expressed in cardiac, smooth, and skeletal muscle, neurons, thymus, kidney and hematopoietic cells.
Shipping & Handling
Constituents
0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose.
Shipping
Shipped at Room Temperature.
Storage
Store at room temperature.