Product Overview
Description
CLPP-00150659 is recombinant human MUC1 protein, Fc Chimera
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG
Sequence Similarities
Contains 1 SEA domain.
Predicted Molecular Weight
42 kDa including tags
Target Information
Alternative Names
Breast carcinoma-associated antigen DF3; CA15-3; Carcinoma-associated mucin; CD227; EMA; Episialin; Epithelial Membrane Antigen; H23AG; KL-6; MAM6; MUC-1; MUC-1/SEC; MUC-1/X; MUC1; MUC1-alpha; MUC1-beta; MUC1-CT; MUC1-NT; MUC1/ZD; MUC1_HUMAN; Mucin 1; Mucin 1 cell surface associated; Mucin-1 subunit beta; Peanut-reactive urinary mucin; PEM; PEMT; Polymorphic epithelial mucin; PUM; Tumor-associated epithelial membrane antigen; Tumor-associated mucin
Protein Function
The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.
Tissue Specificity
Expressed on the apical surface of epithelial cells, especially of airway passages, breast and uterus. Also expressed in activated and unactivated T-cells. Overexpressed in epithelial tumors, such as breast or ovarian cancer and also in non-epithelial tumor cells. Isoform 7 is expressed in tumor cells only.
Involvement in Disease
MUC1/CA 15-3 is used as a serological clinical marker of breast cancer to monitor response to breast cancer treatment and disease recurrence. Decreased levels over time may be indicative of a positive response to treatment. Conversely, increased levels may indicate disease progression. At an early stage disease, only 21% of patients exhibit high MUC1/CA 15-3 levels, that is why CA 15-3 is not a useful screening test. Most antibodies target the highly immunodominant core peptide domain of 20 amino acid (APDTRPAPGSTAPPAHGVTS) tandem repeats. Some antibodies recognize glycosylated epitopes; Tubulointerstitial kidney disease, autosomal dominant, 2 (ADTKD2): A form of autosomal dominant tubulointerstitial kidney disease, a genetically heterogeneous disorder characterized by slowly progressive loss of kidney function, bland urinary sediment, hyperuricemia, absent or mildly increased albuminuria, lack of severe hypertension during the early stages, and normal or small kidneys on ultrasound. Renal histology shows variable abnormalities including interstitial fibrosis with tubular atrophy, microcystic dilatation of the tubules, thickening of tubular basement membranes, medullary cysts, and secondary glomerulosclerotic or glomerulocystic changes with abnormal glomerular tufting. There is significant variability, as well as incomplete penetrance. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Shipping
Shipped at Room Temperature.
Storage
Store at -20 °C or -80 °C.
