Product Overview
Description
CLPP-00150605 is recombinant human EGFR protein, mutated G719S
Applications
Functional Studies, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
SGEAPNQALLRILKETEFKKIKVLSS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLN
TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily. Contains 1 protein kinase domain.
Predicted Molecular Weight
89 kDa including tags
Target Information
Alternative Names
Avian erythroblastic leukemia viral (v erb b) oncogene homolog; Cell growth inhibiting protein 40; Cell proliferation inducing protein 61; EGF R; EGFR; EGFR_HUMAN; Epidermal growth factor receptor; Epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog); Epidermal growth factor receptor (erythroblastic leukemia viral (v erb b) oncogene homolog avian); erb-b2 receptor tyrosine kinase 1; ERBB; ERBB1; Errp; HER1; mENA; NISBD2; Oncogen ERBB; PIG61; Proto-oncogene c-ErbB-1; Receptor tyrosine protein kinase ErbB 1; Receptor tyrosine-protein kinase ErbB-1; SA7; Species antigen 7; Urogastrone; v-erb-b Avian erythroblastic leukemia viral oncogen homolog; wa2; Wa5
Protein Function
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, AREG, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules. May also activate the NF-kappa-B signaling cascade. Also directly phosphorylates other proteins like RGS16, activating its GTPase activity and probably coupling the EGF receptor signaling to the G protein-coupled receptor signaling. Also phosphorylates MUC1 and increases its interaction with SRC and CTNNB1/beta-catenin. Positively regulates cell migration via interaction with CCDC88A/GIV which retains EGFR at the cell membrane following ligand stimulation, promoting EGFR signaling which triggers cell migration. Plays a role in enhancing learning and memory performance (By similarity); Isoform 2 may act as an antagonist of EGF action.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes and facilitates its cell entry. Mediates HCV entry by promoting the formation of the CD81-CLDN1 receptor complexes that are essential for HCV entry and by enhancing membrane fusion of cells expressing HCV envelope glycoproteins.
Tissue Specificity
Ubiquitously expressed. Isoform 2 is also expressed in ovarian cancers.
Involvement in Disease
Lung cancerInflammatory skin and bowel disease, neonatal, 2.
Shipping & Handling
Constituents
0.79% Tris HCl, 0.87% Sodium chloride, 25% Glycerol (glycerin, glycerine), 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF.
Shipping
Shipped on Dry Ice.