Product Overview
Description
CLPP-00150584 is recombinant human EGF protein, Active
Applications
Cell Culture, Functional Studies, HPLC, Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 0.005 Eu/µg
Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Sequence Similarities
Contains 9 EGF-like domains. Contains 9 LDL-receptor class B repeats.
Predicted Molecular Weight
6 kDa
Target Information
Alternative Names
Beta urogastrone; beta-urogastrone; EGF; EGF_HUMAN; Epidermal growth factor; HOMG4; OTTHUMP00000219721; OTTHUMP00000219722; Pro epidermal growth factor; URG; Urogastrone
Protein Function
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro.
Tissue Specificity
Expressed in kidney, salivary gland, cerebrum and prostate.
Involvement in Disease
Hypomagnesemia 4.
Shipping & Handling
Shipping
Shipped at Room Temperature.
Storage
Store at room temperature.