Product Overview
Description
CLPP-00150579 is recombinant human MAPRE2 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
Sequence Similarities
Belongs to the MAPRE family. Contains 1 CH (calponin-homology) domain. Contains 1 EB1 C-terminal domain.
Predicted Molecular Weight
39 kDa including tags
Target Information
Alternative Names
APC binding protein EB1; APC binding protein EB2; APC-binding protein EB2; EB1; EB2; End binding protein 2; End-binding protein 2; H.sapiens mRNA for novel T cell activation protein; MAPRE2; MARE2_HUMAN; Microtubule associated protein RP/EB family member 2; Microtubule-associated protein RP/EB family member 2; RP1; T cell activation protein EB1 family
Protein Function
May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration (By similarity).
Tissue Specificity
Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes.
Involvement in Disease
Skin creases, congenital symmetric circumferential, 2 (CSCSC2): An autosomal dominant disease characterized by multiple, symmetric, circumferential rings of folded skin, affecting primarily the limbs. Affected individuals also exhibit intellectual disability, cleft palate, and dysmorphic features. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
