Product Overview
Description
CLPP-00150574 is recombinant human DYNLRB2 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE
Sequence Similarities
Belongs to the GAMAD family.
Predicted Molecular Weight
13 kDa including tags
Target Information
Alternative Names
Cytoplasmic; DLRB2_HUMAN; DNCL2B; DNLC2B; Dynein light chain 2B; Dynein light chain 2B, cytoplasmic; Dynein light chain roadblock-type 2; DYNLRB2; Roadblock domain-containing protein 2; ROBLD2
Protein Function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
Tissue Specificity
High expression in heart, brain, placenta, skeletal muscle, prostate and small intestine; moderate in kidney, pancreas, spleen, testis, ovary and colon; low in lung, liver, thymus and leukocyte.
Shipping & Handling
Constituents
0.0154% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
