Product Overview
Description
CLPP-00150571 is recombinant human DYNLL2 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sequence Similarities
Belongs to the dynein light chain family.
Predicted Molecular Weight
13 kDa including tags
Target Information
Alternative Names
8 kDa dynein light chain b; C87222; cytoplasmic; Dlc2; DLC8b; DNCL1B; DYL2_HUMAN; Dynein light chain 2; Dynein light chain 2, cytoplasmic; Dynein light chain LC8 type 2; Dynein light chain LC8-type 2; Dynll2; MGC17810; MGC72334
Protein Function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
Shipping & Handling
Constituents
0.0154% DTT, 0.316% Tris HCl, 30% Glycerol (glycerin, glycerine), 1.16% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
