Product Overview
Description
CLPP-00150566 is recombinant human DUSP26 protein, denatured
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Sequence Similarities
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. Contains 1 tyrosine-protein phosphatase domain.
Predicted Molecular Weight
26 kDa
Target Information
Alternative Names
DSP-4; Dual specificity phosphatase 26; Dual specificity phosphatase 26 (putative); Dual specificity phosphatase SKRP3; Dual specificity protein phosphatase 26; DUS26_HUMAN; DUSP24; DUSP26; Hypothetical protein FLJ31142; LDP 4; LDP-4; Low molecular mass dual specificity phosphatase 4; Low-molecular-mass dual-specificity phosphatase 4; MAP kinase phosphatase 8; MGC1136; MGC2627; Mitogen activated protein kinase phosphatase 8; Mitogen-activated protein kinase phosphatase 8; MKP-8; MKP8; NATA1; NATA1 protein; Novel amplified gene in thyroid anaplastic cancer; SKRP3
Protein Function
Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
Tissue Specificity
Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer.
Shipping & Handling
Constituents
2.4% Urea, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
