Product Overview
Description
CLPP-00150559 is recombinant human DNAL1 protein, denatured
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
Sequence Similarities
Belongs to the dynein light chain LC1-type family. Contains 4 LRR (leucine-rich) repeats. Contains 1 LRRCT domain.
Predicted Molecular Weight
24 kDa including tags
Target Information
Alternative Names
Axonemal; Axonemal dynein light chain; Axonemal dynein light chain 1; C14orf168; Chromosome 14 open reading frame 168; CILD16; DNAL 1; dnal1; DNAL1_HUMAN; Dynein axonemal light chain 1; Dynein light chain 1; Dynein light chain 1 axonemal; MGC12435
Protein Function
Part of the multisubunit axonemal ATPase complexes that generate the force for cilia motility and govern beat frequency (By similarity). Component of the outer arm dynein (ODA). May be involved in a mechanosensory feedback mechanism controlling ODA activity based on external conformational cues by tethering the outer arm dynein heavy chain (DNAH5) to the microtubule within the axoneme (By similarity). Important for ciliary function in the airways and for the function of the cilia that produce the nodal flow essential for the determination of the left-right asymmetry.
Tissue Specificity
Expressed in tissues carrying motile cilia such as testis.
Involvement in Disease
Ciliary dyskinesia, primary, 16 (CILD16): A disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
2.4% Urea, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
