Product Overview
Description
CLPP-00150549 is recombinant human DHRS9 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
Sequence Similarities
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Predicted Molecular Weight
36 kDa including tags
Target Information
Alternative Names
3 alpha hydroxysteroid dehydrogenase; 3-@alpha-HSD; 3-@alpha-hydroxysteroid dehydrogenase; 3-alpha hydroxysteroid dehydrogenase; 3-alpha-HSD; 3alpha HSD; Dehydrogenase/reductase SDR family member 9; DHRS9; DHRS9_HUMAN; NADP dependent retinol dehydrogenase/reductase; NADP-dependent retinol dehydrogenase/reductase; RDH-E2; Rdh15; RDHE2; RDHL; RDHTBE; retinol dehydrogenase homolog; Retinol dehydrogenase, tracheobronchiol epithelail cell-specific; RETSDR8; SDR family, member 9; SDR9C4; short chain dehydrogenase/reductase family 9; short chain dehydrogenase/reductase family 9C, member 4; Short chain dehydrogenase/reductase retSDR8; Short-chain dehydrogenase/reductase retSDR8
Protein Function
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. Also plays a role in the biosynthesis of retinoic acid from retinaldehyde. Can utilize both NADH and NADPH.
Tissue Specificity
Highly expressed in trachea and epidermis. Detected at lower levels in spinal cord, bone marrow, brain, tongue, esophagus, heart, colon, testis, placenta, lung, skeletal muscle and lymph node.
Shipping & Handling
Constituents
0.02% PMSF, 0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
