Product Overview
Description
CLPP-00150536 is recombinant human KRT7 protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Sequence Similarities
Belongs to the intermediate filament family.
Predicted Molecular Weight
78 kDa including tags
Target Information
Alternative Names
CK 7; CK-7; CK7; Cytokeratin 7; Cytokeratin-7; D15Wsu77e; K2C7; K2C7_HUMAN; K7; Keratin 7; Keratin 7, type II; Keratin type II cytoskeletal 7; Keratin, 55K type II cytoskeletal; Keratin, simple epithelial; Keratin, simple epithelial type I, K7; Keratin, type II cytoskeletal 7; Keratin-7; Krt2-7; KRT7; MGC11625; MGC129731; MGC3625; Sarcolectin; SCL; Type II mesothelial keratin K7; Type-II keratin Kb7
Protein Function
Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Tissue Specificity
Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
