Product Overview
Description
CLPP-00150525 is recombinant human KRT16 protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQ
Sequence Similarities
Belongs to the intermediate filament family.
Predicted Molecular Weight
36 kDa including tags
Target Information
Alternative Names
CK 16; CK-16; CK16; Cytokeratin 16; Cytokeratin-16; Cytokeratin16; FNEPPK; Focal non epidermolytic palmoplantar keratoderma; K 16; K16; K1C16_HUMAN; K1CP; Keratin; Keratin 1 type I; Keratin 16; Keratin type I cytoskeletal 16; Keratin-16; Keratin16; KRT 16; Krt16; KRT16A; NEPPK; PC1; type I cytoskeletal 16
Protein Function
Epidermis-specific type I keratin that plays a key role in skin. Acts as a regulator of innate immunity in response to skin barrier breach: required for some inflammatory checkpoint for the skin barrier maintenance.
Tissue Specificity
Expressed in the hair follicle, nail bed and in mucosal stratified squamous epithelia and, suprabasally, in oral epithelium and palmoplantar epidermis. Also found in luminal cells of sweat and mammary gland ducts.
Involvement in Disease
Defects in KRT16 are a cause of pachyonychia congenita type 1 (PC1); also known as Jadassohn-Lewandowsky syndrome. PC1 is an autosomal dominant ectodermal dysplasia characterized by hypertrophic nail dystrophy resulting in onchyogryposis (thickening and increase in curvature of the nail), palmoplantar keratoderma, follicular hyperkeratosis, and oral leukokeratosis. Hyperhidrosis of the hands and feet is usually present.Defects in KRT16 are the cause of palmoplantar keratoderma non-epidermolytic focal (FNEPPK). A dermatological disorder characterized by non-epidermolytic palmoplantar keratoderma limited to the pressure points on the balls of the feet, with later mild involvement on the palms. Oral, genital and follicular keratotic lesions are often present.Defects in KRT16 are a cause of unilateral palmoplantar verrucous nevus (UPVN). UPVN is characterized by a localized thickening of the skin in parts of the right palm and the right sole.KRT16 and KRT17 are coexpressed only in pathological situations such as metaplasias and carcinomas of the uterine cervix and in psoriasis vulgaris.
Shipping & Handling
Constituents
0.3% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.